« Zurück
Home /
Recombinant Human CCN family member 1(CCN1)

Recombinant Human CCN family member 1(CCN1)

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	E.coli
ArtNr	CSB-EP006463HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Stem Cells
Target / Protein	CYR61
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	O00622
AA Sequence	TCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQ LNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQ SEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAVG CIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCD EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELI AVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTT SWSQCSKTCGTGISTRVTNDNPECRLVKETRICEV RPCGQPVYSSLKKGKKCSKTKKSPEPVRFTYAGCL SVKKYRPKYCGSCVDGRCCTPQLTRTVKMRFRCED GETFSKNVMMIQSCKCNYNCPHANEAAFPFYRLFN DIHKFRD
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	25-381aa
Protein length	Full Length of Mature Protein
MW	55.4 kDa
Alternative Name(s)	CCN family member 1 Cysteine-rich angiogenic inducer 61 Insulin-like growth factor-binding protein 10 Short name: IBP-10 Short name: IGF-binding protein 10 Short name: IGFBP-10 Protein GIG1
Relevance	Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3.
References	"The angiogenic factor Cyr61 activates a genetic program for wound healing in human skin fibroblasts."Chen C.-C., Mo F.-E., Lau L.F.J. Biol. Chem. 276:47329-47337(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3.
Subcellular Location	Secreted
Protein Families	CCN family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP006463HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen