« Back
Home /
Recombinant Human CCN family member 1(CCN1)

Recombinant Human CCN family member 1(CCN1)

Manufacturer	Cusabio
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP006463HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research areas	Stem Cells
Target / Protein	CYR61
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	O00622
AA Sequence	TCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQ LNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQ SEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAVG CIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCD EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELI AVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTT SWSQCSKTCGTGISTRVTNDNPECRLVKETRICEV RPCGQPVYSSLKKGKKCSKTKKSPEPVRFTYAGCL SVKKYRPKYCGSCVDGRCCTPQLTRTVKMRFRCED GETFSKNVMMIQSCKCNYNCPHANEAAFPFYRLFN DIHKFRD
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	25-381aa
Protein length	Full Length of Mature Protein
MW	55.4 kDa
Alternative Name(s)	CCN family member 1 Cysteine-rich angiogenic inducer 61 Insulin-like growth factor-binding protein 10 Short name: IBP-10 Short name: IGF-binding protein 10 Short name: IGFBP-10 Protein GIG1
Relevance	Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3.
References	"The angiogenic factor Cyr61 activates a genetic program for wound healing in human skin fibroblasts."Chen C.-C., Mo F.-E., Lau L.F.J. Biol. Chem. 276:47329-47337(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3.
Subcellular Location	Secreted
Protein Families	CCN family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP006463HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time