« Zurück
Startseite /
Recombinant Human Decorin(DCN),partial

Recombinant Human Decorin(DCN),partial

ArtNr	CSB-EP006554HU1-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	QQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVC PFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQ NNKITEIKDGDFKNLKNLHALILVNNKISKVSPGA FTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHE NEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENG AFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLD GNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGS LAN
Protein Familie	Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Citations	Primary structure of an Extracellular domain matrix proteoglycan core protein deduced from cloned cDNA.Krusius T., Ruoslahti E.Proc. Natl. Acad. Sci. U.S.A. 83:7683-7687(1986)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Bone proteoglycan IIPG-S2;PG40
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	41.7 kDa
General Research Areas	Signal Transduction
Relevance	May affect the rate of fibrils formation.
Expression Region	20-359aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May affect the rate of fibrils formation.
Subcellular Location	Secreted, extracellular space, extracellular matrix
Involvement in disease	Corneal dystrophy, congenital stromal (CSCD)
Paythway	TGF-betasignalingpathway
Gene Names	DCN
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP006554HU1-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 16.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern