Vergleich

Recombinant Mouse Alpha-enolase(Eno1),partial

ArtNr CSB-EP007670MOb0-50
Hersteller Cusabio
Menge 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVP SGASTGIYEALELRDNDKTRFMGKGVSQAVEHINK TIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKF GANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNP EVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAS SFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEG GFAPNILENKEALELLKTAIAKAGYTDQVVIGMDV AAS
Protein Familie Enolase family
Citations "Cholesteryl ester loading of mouse peritoneal macrophages is associated with changes in the expression or modification of specific cellular proteins, including increase in an alpha-enolase isoform."
Bottalico L.A., Kendrick N.C., Keller A., Li Y., Tabas I.
Arterioscler. Thromb. 13:264-275(1993)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 2-phospho-D-glycerate hydro-lyase,Enolase 1,Non-neural enolase
Lieferbar
Manufacturer - Targets
Eno1
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
50.4 kDa
General Research Areas
Signal Transduction
Relevance
Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production
Expression Region
2-433aa
Protein Length
Partial
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses (By similarity). May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production (By similarity).
Subcellular Location
Cytoplasm, Cell membrane
Tissue Specificity
Testis. Found in the principal piece of sperm tail (at protein level). The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons. In striated muscle, expression of ENO1 appears to be independent of fiber type.
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen