Vergleich

Recombinant Human Receptor tyrosine-protein kinase erbB-2(ERBB2),partial

ArtNr CSB-EP007763HU-10
Hersteller Cusabio
Menge 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQ GNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVR QVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTT PVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLC YQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSP MCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLP TDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELH CPA
Protein Familie Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily
Citations Similarity of protein encoded by the human c-erb-B-2 gene to epidermal growth factor receptor.Yamamoto T., Ikawa S., Akiyama T., Semba K., Nomura N., Miyajima N., Saito T., Toyoshima K.Nature 319:230-234(1986)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Metastatic lymph node gene 19 protein ,MLN 19Proto-oncogene NeuProto-oncogene c-ErbB-2Tyrosine kinase-type cell surface receptor HER2p185erbB2,CD340
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
73.3 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Transcription
Relevance
Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell mbrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell mbrane. In turn, mbrane-bound APC allows the localization of MACF1 to the cell mbrane, which is required for microtubule capture and stabilization.In the nucleus is involved in transcriptional regulation. Associates with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter and activates its transcription. Implicated in transcriptional activation of CDKN1A; the function involves STAT3 and SRC. Involved in the transcription of rRNA genes by RNA Pol I and enhances protein synthesis and cell growth.
Expression Region
23-652aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization.
Subcellular Location
Isoform 1: Cell membrane, Single-pass type I membrane protein, Cytoplasm, perinuclear region, Nucleus
Tissue Specificity
Expressed in a variety of tumor tissues including primary breast tumors and tumors from small bowel, esophagus, kidney and mouth.
Involvement in disease
Glioma (GLM); Ovarian cancer (OC); Lung cancer (LNCR); Gastric cancer (GASC)
Pathway
Calciumsignalingpathway
Gene Names
ERBB2
Sequence Info
Extracellular Domain
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen