Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
200ug |
Host |
E.coli |
ArtNr |
CSB-EP008619HU-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Signal Transduction |
Uniprot ID |
Q92913 |
Gene Names |
FGF13 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGK TSCDKNKLNVFSRVKLFGSKKRRRRRPEPQLKGIV TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLI PVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPE CKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNK EGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLH DLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST |
Expression Region |
1-245aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
31.6 kDa |
Alternative Name(s) |
Fibroblast growth factor homologous factor 2 Short name: FHF-2 |
Relevance |
Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus. May regulate voltage-gated sodium channels transport and function. May also play a role in MAPK signaling. |
Reference |
"Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development."Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J.Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus. |
Subcellular Location |
Cell projection, filopodium, Cell projection, growth cone, Cell projection, dendrite, Nucleus, Cytoplasm |
Protein Families |
Heparin-binding growth factors family |
Tissue Specificity |
Ubiquitously expressed. Predominantly expressed in the nervous system. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.