« Back
Home /
Recombinant Human Fibroblast growth factor 13(FGF13)

Recombinant Human Fibroblast growth factor 13(FGF13)

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Brain Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-EP008619HU-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	Q92913
Gene Names	FGF13
Organism	Homo sapiens (Human)
AA Sequence	MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGK TSCDKNKLNVFSRVKLFGSKKRRRRRPEPQLKGIV TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLI PVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPE CKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNK EGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLH DLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST
Expression Region	1-245aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	31.6 kDa
Alternative Name(s)	Fibroblast growth factor homologous factor 2 Short name: FHF-2
Relevance	Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus. May regulate voltage-gated sodium channels transport and function. May also play a role in MAPK signaling.
Reference	"Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development."Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J.Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus.
Subcellular Location	Cell projection, filopodium, Cell projection, growth cone, Cell projection, dendrite, Nucleus, Cytoplasm
Protein Families	Heparin-binding growth factors family
Tissue Specificity	Ubiquitously expressed. Predominantly expressed in the nervous system.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time