« Zurück
Home /
Recombinant Human Grancalcin(GCA)

Recombinant Human Grancalcin(GCA)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP009307HU-10
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	P28676
Gene Names	GCA
Organism	Homo sapiens (Human)
AA Sequence	MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILL DGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDA EELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDH TGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVE HHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFF DDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDF LQGTMAI
Expression Region	1-217aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	51 kDa
Relevance	Calcium-binding protein that may play a role in the adhesion of neutrophils to fibronectin. May play a role in the formation of focal adhesions.
Reference	"Biochemical characterization of the penta-EF-hand protein grancalcin and identification of L-plastin as a binding partner." Lollike K., Johnsen A.H., Durussel I., Borregaard N., Cox J.A. J. Biol. Chem. 276:17762-17769(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Calcium-binding protein that may play a role in the adhesion of neutrophils to fibronectin. May play a role in the formation of focal adhesions.
Subcellular Location	Cytoplasm, Cytoplasmic granule membrane, Peripheral membrane protein, Cytoplasmic side
Tissue Specificity	Detected in neutrophils and macrophages (at protein level). Highly expressed in bone marrow.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP009307HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen