« Zurück
Home /
Recombinant Human Growth/differentiation factor 11(GDF11)

Recombinant Human Growth/differentiation factor 11(GDF11)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP009344HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Neuroscience
Target / Protein	GDF11
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	O95390
AA Sequence	NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAP KRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSA GPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDR CGCS
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	299-407aa
Protein length	Full Length of Mature Protein
MW	28.5 kDa
Alternative Name(s)	Bone morphogenetic protein 11 Short name: BMP-11
Relevance	Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. Play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern.
References	"A novel BMP expressed in developing mouse limb, spinal cord, and tail bud is a potent mesoderm inducer in Xenopus embryos."Gamer L.W., Wolfman N.M., Celeste A.J., Hattersley G., Hewick R., Rosen V.Dev. Biol. 208:222-232(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. May play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern (By similarity). Signals through activin receptors type-2, ACVR2A and ACVR2B, and activin receptors type-1, ACVR1B, ACVR1C and TGFBR1 leading to the phosphorylation of SMAD2 and SMAD3
Subcellular Location	Secreted
Protein Families	TGF-beta family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen