« Zurück
Startseite /
Recombinant Pig Somatotropin(GH1)

Recombinant Pig Somatotropin(GH1)

ArtNr	CSB-EP009407PI(A4)-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MAAGPRTSALLAFALLCLPWTREVGAFPAMPLSSL FANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSI QNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSL LLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKD LEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLR SDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFV ESSCAF
Protein Familie	Somatotropin/prolactin family
Citations	"Porcine growth hormone: molecular cloning of cDNA and expression in bacterial and mammalian cells." Kato Y., Shimokawa N., Kato T., Hirai T., Yoshihama K., Kawai H., Hattori M.A., Ezashi T., Shimogori Y., Wakabayashi K. Biochim. Biophys. Acta 1048:290-293(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Growth hormone
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	29.4 kDa
General Research Areas	Developmental Biology
Relevance	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Expression Region	1-216aa
Protein Length	Full Length
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Subcellular Location	Secreted
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern