« Zurück
Home /
Recombinant Human Glutaminase kidney isoform, mitochondrial(GLS),partial

Recombinant Human Glutaminase kidney isoform, mitochondrial(GLS),partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP009528HU(F)-10
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Metabolism
Uniprot ID	O94925
Gene Names	GLS
Organism	Homo sapiens (Human)
AA Sequence	YVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEG TDMVGILDFYFQLCSIEVTCESASVMAATLANGGF CPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAF HVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMG NSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR EGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDM EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPF PKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQ GDSDNGKENQTVHKNLDGLL
Expression Region	370-669aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	60.4 kDa
Alternative Name(s)	K-glutaminase L-glutamine amidohydrolase
Relevance	Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity.
Reference	"Cloning and analysis of unique human glutaminase isoforms generated by tissue-specific alternative splicing."Elgadi K.M., Meguid R.A., Qian M., Souba W.W., Abcouwer S.F.Physiol. Genomics 1:51-62(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity.
Subcellular Location	Isoform 1: Cytoplasm, cytosol, SUBCELLULAR LOCATION: Isoform 3: Mitochondrion
Protein Families	Glutaminase family
Tissue Specificity	Isoform 1 and isoform 3 are detected in brain cortex. Isoform 3 is highly expressed in astrocytoma, ganglioglioma and ependymoma. Isoform 1 is highly expressed in brain and kidney, but not detected in liver. Isoform 3 is highly expressed in heart and pancreas, detected at lower levels in placenta, lung, pancreas and kidney, but is not detected in liver. Isoform 2 is expressed in cardiac and skeletal muscle.
Paythway	Glutamatergicsynapse
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen