Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
E.coli |
ArtNr |
CSB-EP009539BO-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
P68265 |
Gene Names |
GLTP |
Organism |
Bos taurus (Bovine) |
AA Sequence |
ALLAEHLLRPLPADKQIETGPFLEAVSHLPPFFDC LGSPVFTPIKADISGNITKIKAVYDTNPTKFRTLQ NILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQV FLQSICDGERDENHPNLIRVNATKAYEMALKKYHG WIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEEC LEKVRLFLVNYTATIDVIYEMYTRMNAELNYKV |
Expression Region |
2-209aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
39.8 kDa |
Alternative Name(s) |
GLTP |
Relevance |
Accelerates the intermembrane transfer of various glycolipids. Catalyzes the transfer of various glycosphingolipids between membranes but does not catalyze the transfer of phospholipids. May be involved in the intracellular translocation of glucosylceramides. |
Reference |
"Cloning and expression of glycolipid transfer protein from bovine and porcine brain."Lin X., Mattjus P., Pike H.M., Windebank A.J., Brown R.E.J. Biol. Chem. 275:5104-5110(2000) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Accelerates the intermembrane transfer of various glycolipids. Catalyzes the transfer of various glycosphingolipids between membranes but does not catalyze the transfer of phospholipids. May be involved in the intracellular translocation of glucosylceramides. |
Subcellular Location |
Cytoplasm |
Protein Families |
GLTP family |
Tissue Specificity |
Detected in brain, kidney, spleen, lung, cerebellum, liver and heart. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.