« Zurück
Home /
Recombinant Bovine Glycolipid transfer protein(GLTP)

Recombinant Bovine Glycolipid transfer protein(GLTP)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP009539BO-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	P68265
Gene Names	GLTP
Organism	Bos taurus (Bovine)
AA Sequence	ALLAEHLLRPLPADKQIETGPFLEAVSHLPPFFDC LGSPVFTPIKADISGNITKIKAVYDTNPTKFRTLQ NILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQV FLQSICDGERDENHPNLIRVNATKAYEMALKKYHG WIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEEC LEKVRLFLVNYTATIDVIYEMYTRMNAELNYKV
Expression Region	2-209aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	39.8 kDa
Alternative Name(s)	GLTP
Relevance	Accelerates the intermembrane transfer of various glycolipids. Catalyzes the transfer of various glycosphingolipids between membranes but does not catalyze the transfer of phospholipids. May be involved in the intracellular translocation of glucosylceramides.
Reference	"Cloning and expression of glycolipid transfer protein from bovine and porcine brain."Lin X., Mattjus P., Pike H.M., Windebank A.J., Brown R.E.J. Biol. Chem. 275:5104-5110(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Accelerates the intermembrane transfer of various glycolipids. Catalyzes the transfer of various glycosphingolipids between membranes but does not catalyze the transfer of phospholipids. May be involved in the intracellular translocation of glucosylceramides.
Subcellular Location	Cytoplasm
Protein Families	GLTP family
Tissue Specificity	Detected in brain, kidney, spleen, lung, cerebellum, liver and heart.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP009539BO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen