Comparison

Recombinant Bovine Glycolipid transfer protein(GLTP)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP009539BO-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
GLTP
AA Sequence
ALLAEHLLRPLPADKQIETGPFLEAVSHLPPFFDC LGSPVFTPIKADISGNITKIKAVYDTNPTKFRTLQ NILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQV FLQSICDGERDENHPNLIRVNATKAYEMALKKYHG WIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEEC LEKVRLFLVNYTATIDVIYEMYTRMNAELNYKV
Research Topic
Others
Uniprot ID
P68265
Gene Names
GLTP
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-209aa
MW of Fusion Proten
39, 8
Sequence Info
Full Length
Relevance
Accelerates the intermembrane transfer of various glycolipids. Catalyzes the transfer of various glycosphingolipids between membranes but does not catalyze the transfer of phospholipids. May be involved in the intracellular translocation of glucosylceramides.
Reference
"Cloning and expression of glycolipid transfer protein from bovine and porcine brain."Lin X., Mattjus P., Pike H.M., Windebank A.J., Brown R.E.J. Biol. Chem. 275:5104-5110(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Bos taurus (Bovine)
Amount: 10ug
Available: In stock
Listprice: €246.81
Price: €246.81
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close