Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
E.coli |
ArtNr |
CSB-EP009553DXU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Neuroscience |
Uniprot ID |
P04773 |
Gene Names |
GLUL |
Organism |
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) |
AA Sequence |
ATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGT GEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSE SSNSDMYLSPVAMFRDPFRKEPNKLVFCEVFKYNQ KPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLLG TDGHPFGWPSDGFPGPQGLYYCGVGADKAYRRDIM EAHYRACLYAGVKITGTYAEVKHAQWEFQIGPCEG IRMGDHLWVARFILHRVCKDFGVIATFDSKPIPGN WNGAGCHTNFSTKTMREENGLKHIKEAIEKLSKRH RYHIRAYDPKGGLDNARRLTGFHKTSNINDFSAGV ADRSASIRIPRTVGQEKKGYFEARCPSANCDPFAV TEAIVRTCLLNETGDQPFQYKN |
Expression Region |
2-373aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
58.2 kDa |
Alternative Name(s) |
GS Glutamate decarboxylase Glutamate--ammonia ligase |
Relevance |
Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity). |
Reference |
"The cloning and nucleotide sequence of cDNA for an amplified glutamine synthetase gene from the Chinese hamster."Hayward B.E., Hussain A., Wilson R.H., Lyons A., Woodcock V., McIntosh B., Harris T.J.R.Nucleic Acids Res. 14:999-1008(1986) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions |
Subcellular Location |
Cytoplasm, Mitochondrion |
Protein Families |
Glutamine synthetase family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.