« Zurück
Home /
Recombinant Cricetulus griseus Glutamine synthetase(GLUL)

Recombinant Cricetulus griseus Glutamine synthetase(GLUL)

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Microglia Markers
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP009553DXU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Neuroscience
Uniprot ID	P04773
Gene Names	GLUL
Organism	Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
AA Sequence	ATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGT GEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSE SSNSDMYLSPVAMFRDPFRKEPNKLVFCEVFKYNQ KPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLLG TDGHPFGWPSDGFPGPQGLYYCGVGADKAYRRDIM EAHYRACLYAGVKITGTYAEVKHAQWEFQIGPCEG IRMGDHLWVARFILHRVCKDFGVIATFDSKPIPGN WNGAGCHTNFSTKTMREENGLKHIKEAIEKLSKRH RYHIRAYDPKGGLDNARRLTGFHKTSNINDFSAGV ADRSASIRIPRTVGQEKKGYFEARCPSANCDPFAV TEAIVRTCLLNETGDQPFQYKN
Expression Region	2-373aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	58.2 kDa
Alternative Name(s)	GS Glutamate decarboxylase Glutamate--ammonia ligase
Relevance	Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity).
Reference	"The cloning and nucleotide sequence of cDNA for an amplified glutamine synthetase gene from the Chinese hamster."Hayward B.E., Hussain A., Wilson R.H., Lyons A., Woodcock V., McIntosh B., Harris T.J.R.Nucleic Acids Res. 14:999-1008(1986)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions
Subcellular Location	Cytoplasm, Mitochondrion
Protein Families	Glutamine synthetase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen