Comparison

Recombinant Cricetulus griseus Glutamine synthetase(GLUL)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP009553DXU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
GS
Glutamate decarboxylase
Glutamate--ammonia ligase
AA Sequence
ATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGT GEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSE SSNSDMYLSPVAMFRDPFRKEPNKLVFCEVFKYNQ KPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLLG TDGHPFGWPSDGFPGPQGLYYCGVGADKAYRRDIM EAHYRACLYAGVKITGTYAEVKHAQWEFQIGPCEG IRMGDHLWVARFILHRVCKDFGVIATFDSKPIPGN WNGAGCHTNFSTKTMREENGLKHIKEAIEKLSKRH RYHIRAYDPKGGLDNARRLTGFHKTSNINDFSAGV ADRSASIRIPRTVGQEKKGYFEARCPSANCDPFAV TEAIVRTCLLNETGDQPFQYKN
Research Topic
Neuroscience
Uniprot ID
P04773
Gene Names
GLUL
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-373aa
MW of Fusion Proten
58, 2
Sequence Info
Full Length
Relevance
Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity).
Reference
"The cloning and nucleotide sequence of cDNA for an amplified glutamine synthetase gene from the Chinese hamster."Hayward B.E., Hussain A., Wilson R.H., Lyons A., Woodcock V., McIntosh B., Harris T.J.R.Nucleic Acids Res. 14:999-1008(1986)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Amount: 10ug
Available: In stock
Listprice: €246.81
Price: €246.81
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close