« Zurück
Home /
Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)

Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)

Hersteller	Cusabio
Kategorie	Metabolism Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP009681BO-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Metabolism
Uniprot ID	P12344
Gene Names	GOT2
Organism	Bos taurus (Bovine)
AA Sequence	GLAAAASARASSWWAHVEMGPPDPILGVTEAFKRD TNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA KNLDKEYLPIAGLAEFCKASAELALGENNEVLKSG RYVTVQTISGTGALRIGASFLQRFFKFSRDVFLPK PTWGNHTPIFRDAGMQLQSYRYYDPKTCGFDFTGA IEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEM ATVVKKNNLFAFFDMAYQGFASGDGNKDAWAVRHF IEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAE EAKRVESQLKILIRPMYSNPPINGARIASTILTSP DLRKQWLHEVKGMADRIISMRTQLVSNLKKEGSSH NWQHIIDQIGMFCYTGLKPEQVERLTKEFSIYMTK DGRISVAGVTSGNVAYLAHAIHQVTK
Expression Region	20-430aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	61.5 kDa
Alternative Name(s)	Fatty acid-binding protein Short name: FABP-1 Glutamate oxaloacetate transaminase 2 Kynurenine aminotransferase 4 Kynurenine aminotransferase IV Kynurenine--oxoglutarate transaminase 4 Kynurenine--oxoglutarate transaminase IV Plasma membrane-associated fatty acid-binding protein Short name: FABPpm Transaminase A
Relevance	Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids (By similarity).
Reference	"Nucleotide sequence of a cDNA coding for bovine mitochondrial aspartate aminotransferase."Palmisano A., Aurilia V., Ferrara L., Cubellis M.V., Sannia G., Marino G.Int. J. Biochem. Cell Biol. 27:507-511(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids (By similarity).
Subcellular Location	Mitochondrion matrix, Cell membrane
Protein Families	Class-I pyridoxal-phosphate-dependent aminotransferase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP009681BO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen