Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Bovine
Amount 10ug
Host E.coli
Item no. CSB-EP009681BO-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P12344
Gene Names
GOT2
Organism
Bos taurus (Bovine)
AA Sequence
GLAAAASARASSWWAHVEMGPPDPILGVTEAFKRD TNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA KNLDKEYLPIAGLAEFCKASAELALGENNEVLKSG RYVTVQTISGTGALRIGASFLQRFFKFSRDVFLPK PTWGNHTPIFRDAGMQLQSYRYYDPKTCGFDFTGA IEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEM ATVVKKNNLFAFFDMAYQGFASGDGNKDAWAVRHF IEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAE EAKRVESQLKILIRPMYSNPPINGARIASTILTSP DLRKQWLHEVKGMADRIISMRTQLVSNLKKEGSSH NWQHIIDQIGMFCYTGLKPEQVERLTKEFSIYMTK DGRISVAGVTSGNVAYLAHAIHQVTK
Expression Region
20-430aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
61.5 kDa
Alternative Name(s)
Fatty acid-binding protein
Short name:
FABP-1
Glutamate oxaloacetate transaminase 2
Kynurenine aminotransferase 4
Kynurenine aminotransferase IV
Kynurenine--oxoglutarate transaminase 4
Kynurenine--oxoglutarate transaminase IV
Plasma membrane-associated fatty acid-binding protein
Short name:
FABPpm
Transaminase A
Relevance
Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids (By similarity).
Reference
"Nucleotide sequence of a cDNA coding for bovine mitochondrial aspartate aminotransferase."Palmisano A., Aurilia V., Ferrara L., Cubellis M.V., Sannia G., Marino G.Int. J. Biochem. Cell Biol. 27:507-511(1995)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €246.82
Price: €246.82
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close