« Back
Home /
Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)

Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)

Manufacturer	Cusabio
Category	Metabolism Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP009681BO-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Metabolism
Uniprot ID	P12344
Gene Names	GOT2
Organism	Bos taurus (Bovine)
AA Sequence	GLAAAASARASSWWAHVEMGPPDPILGVTEAFKRD TNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA KNLDKEYLPIAGLAEFCKASAELALGENNEVLKSG RYVTVQTISGTGALRIGASFLQRFFKFSRDVFLPK PTWGNHTPIFRDAGMQLQSYRYYDPKTCGFDFTGA IEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEM ATVVKKNNLFAFFDMAYQGFASGDGNKDAWAVRHF IEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAE EAKRVESQLKILIRPMYSNPPINGARIASTILTSP DLRKQWLHEVKGMADRIISMRTQLVSNLKKEGSSH NWQHIIDQIGMFCYTGLKPEQVERLTKEFSIYMTK DGRISVAGVTSGNVAYLAHAIHQVTK
Expression Region	20-430aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	61.5 kDa
Alternative Name(s)	Fatty acid-binding protein Short name: FABP-1 Glutamate oxaloacetate transaminase 2 Kynurenine aminotransferase 4 Kynurenine aminotransferase IV Kynurenine--oxoglutarate transaminase 4 Kynurenine--oxoglutarate transaminase IV Plasma membrane-associated fatty acid-binding protein Short name: FABPpm Transaminase A
Relevance	Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids (By similarity).
Reference	"Nucleotide sequence of a cDNA coding for bovine mitochondrial aspartate aminotransferase."Palmisano A., Aurilia V., Ferrara L., Cubellis M.V., Sannia G., Marino G.Int. J. Biochem. Cell Biol. 27:507-511(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids (By similarity).
Subcellular Location	Mitochondrion matrix, Cell membrane
Protein Families	Class-I pyridoxal-phosphate-dependent aminotransferase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP009681BO-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time