« Back
Home /
Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)

Recombinant Bovine Aspartate aminotransferase, mitochondrial(GOT2)

Item no.	CSB-EP009681BO-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Metabolism Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GLAAAASARASSWWAHVEMGPPDPILGVTEAFKRD TNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAA KNLDKEYLPIAGLAEFCKASAELALGENNEVLKSG RYVTVQTISGTGALRIGASFLQRFFKFSRDVFLPK PTWGNHTPIFRDAGMQLQSYRYYDPKTCGFDFTGA IEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEM ATVVKKNNLFAFFDMAYQGFASGDGNKDAWAVRHF IEQ
Protein Family	Class-I pyridoxal-phosphate-dependent aminotransferase family
Citations	"Nucleotide sequence of a cDNA coding for bovine mitochondrial aspartate aminotransferase."Palmisano A., Aurilia V., Ferrara L., Cubellis M.V., Sannia G., Marino G.Int. J. Biochem. Cell Biol. 27:507-511(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fatty acid-binding protein; Short name:; FABP-1; Glutamate oxaloacetate transaminase 2; Kynurenine aminotransferase 4; Kynurenine aminotransferase IV; Kynurenine--oxoglutarate transaminase 4; Kynurenine--oxoglutarate transaminase IV; Plasma membrane-associated fatty acid-binding protein; Short name:; FABPpm; Transaminase A
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	61.5 kDa
General Research Areas	Metabolism
Relevance	Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids (By similarity).
Expression Region	20-430aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids (By similarity).
Subcellular Location	Mitochondrion matrix, Cell membrane
Gene Names	GOT2
Sequence Info	Full Length of Mature Protein
Organism	Bos taurus (Bovine)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP009681BO-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer