« Zurück
Home /
Recombinant Human Epididymal secretory glutathione peroxidase(GPX5)

Recombinant Human Epididymal secretory glutathione peroxidase(GPX5)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Menge	10ug
Host	E.coli
ArtNr	CSB-EP009870HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	O75715
Gene Names	GPX5
Organism	Homo sapiens (Human)
AA Sequence	MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKD EKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVA TYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
Expression Region	1-100aa
Sequence Info	Full Length of Isoform 2
Source	E.coli
Tag Info	N-terminal 6xHis-Trx-tagged
MW	28.4 kDa
Alternative Name(s)	Epididymis-specific glutathione peroxidase-like protein
Relevance	Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Reference	"The majority of human glutathione peroxidase type 5 (GPX5) transcripts are incorrectly spliced: implications for the role of GPX5 in the male reproductive tract." Hall L., Williams K., Perry A.C.F., Frayne J., Jury J.A. Biochem. J. 333:5-9(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Subcellular Location	Secreted
Protein Families	Glutathione peroxidase family
Tissue Specificity	Epididymis.
Paythway	Th17celldifferentiation

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

nicht lieferbar