Vergleich

Recombinant Mouse Granzyme A(Gzma)

ArtNr CSB-EP010081MO-50
Hersteller Cusabio
Menge 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNW VLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKK AFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILH LPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREV NITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGG KDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWP GVYTFLSDKHLNWIKKIMKGSV
Protein Familie Peptidase S1 family, Granzyme subfamily
Citations "Genomic organization of the mouse granzyme A gene. Two mRNAs encode the same mature granzyme A with different leader peptides."
Hershberger R.J., Gershenfeld H.K., Weissman I.L., Su L.
J. Biol. Chem. 267:25488-25493(1992)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Autocrine thymic lymphoma granzyme-like serine protease,CTLA-3,Fragmentin-1,T cell-specific serine protease 1
Lieferbar
Manufacturer - Targets
Gzma
Manufacturer - Conjugate / Tag
N-terminal 6xHis-B2M-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
39.6 kDa
General Research Areas
Cell Biology
Relevance
Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA
Expression Region
29-260aa
Protein Length
Full Length of Mature Protein
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA (By similarity).
Subcellular Location
Secreted, Cytoplasmic granule
Tissue Specificity
Found in cytotoxic lymphocytes and in normal lymphoid tissues such as thymus and spleen.
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen