Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
E.coli |
ArtNr |
CSB-EP010087HU-10 |
Konjugat/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
P07305 |
Gene Names |
H1F0 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAA IQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKL SIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSV AFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKA TPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKK AKPVKPKAKSSAKRAGKKK |
Expression Region |
1-194aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
47.9 kDa |
Alternative Name(s) |
Histone H1' Histone H1(0) |
Relevance |
Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division. |
Reference |
"Differential distribution of lysine and arginine residues in the closely related histones H1 and H5. Analysis of a human H1 gene." Doenecke D., Tonjes R. J. Mol. Biol. 187:461-464(1986) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division. |
Subcellular Location |
Nucleus, Chromosome |
Protein Families |
Histone H1/H5 family |
Tag Information |
N-terminal 6xHis-GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.