Comparison

Recombinant Human Histone H1.0(H1F0)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP010087HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Histone H1'
Histone H1(0)
AA Sequence
MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAA IQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKL SIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSV AFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKA TPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKK AKPVKPKAKSSAKRAGKKK
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P07305
Gene Names
H1F0
Tag Info
N-terminal GST-tagged
Expression Region
1-194aa
MW of Fusion Proten
47, 9
Sequence Info
Full Length
Relevance
Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.
Reference
"Differential distribution of lysine and arginine residues in the closely related histones H1 and H5. Analysis of a human H1 gene."
Doenecke D., Tonjes R.
J. Mol. Biol. 187:461-464(1986)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close