« Zurück
Startseite /
Recombinant Human Hyaluronan and proteoglycan link protein 1(HAPLN1)

Recombinant Human Hyaluronan and proteoglycan link protein 1(HAPLN1)

ArtNr	CSB-EP010130HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVF SHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLT SDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDS DASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALD LQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIAS FDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREP CGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGR FYY
Protein Familie	HAPLN family
Citations	"The brain link protein-1 (BRAL1): cDNA cloning, genomic structure, and characterization as a novel link protein expressed in adult brain." Hirakawa S., Oohashi T., Su W.-D., Yoshioka H., Murakami T., Arata J., Ninomiya Y. Biochem. Biophys. Res. Commun. 276:982-989(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cartilage-linking protein 1; Short name:; Cartilage-link protein; Proteoglycan link protein; CRTL1
Lieferbar
Manufacturer - Targets	HAPLN1
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	44.0 kDa
General Research Areas	Signal Transduction
Relevance	Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
Expression Region	16-354aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
Subcellular Location	Secreted, extracellular space, extracellular matrix
Tissue Specificity	Widely expressed. Weakly expressed in the brain.
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP010130HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern