« Zurück
Home /
Recombinant Human Orexin receptor type 1(HCRTR1),partial

Recombinant Human Orexin receptor type 1(HCRTR1),partial

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Metabolism Glucose Homeostasis Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
ArtNr	CSB-EP010231HU1-500
Konjugat/Tag	Myc
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Metabolism
Uniprot ID	O43613
Gene Names	HCRTR1
Organism	Homo sapiens (Human)
AA Sequence	MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYL WRDYLYPKQYE
Expression Region	1-46aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	10.4 kDa
Alternative Name(s)	Hypocretin receptor type 1
Relevance	Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca2+ levels in response to orexin-A binding
Reference	"Structure and ligand-binding mechanism of the human OX1 and OX2 orexin receptors." Yin J., Babaoglu K., Brautigam C.A., Clark L., Shao Z., Scheuermann T.H., Harrell C.M., Gotter A.L., Roecker A.J., Winrow C.J., Renger J.J., Coleman P.J., Rosenbaum D.M. Nat. Struct. Mol. Biol. 23:293-299(2016)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide
Subcellular Location	Cell membrane, Multi-pass membrane protein
Protein Families	G-protein coupled receptor 1 family
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen