Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
ArtNr |
CSB-EP010565MO1-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research areas |
Cardiovascular |
Target / Protein |
Hmgcr |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
Q01237 |
AA Sequence |
GRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINK NLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQ NVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTV GGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR IVCGTVMAGELSLMAALAAGH |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
700-860aa |
Protein length |
Partial |
MW |
20.4 kDa |
Relevance |
Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins. |
References |
"Glucocorticoid-regulated gene expression in the immune system. Analysis of glucocorticoid-regulated transcripts from the mouse macrophage-like cell line P388D1." Helmberg A., Faessler R., Geley S., Joehrer K., Kroemer G., Boeck G., Kofler R. J. Immunol. 145:4332-4337(1990) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins. |
Subcellular Location |
Endoplasmic reticulum membrane, Multi-pass membrane protein |
Protein Families |
HMG-CoA reductase family |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.