Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
E.coli |
ArtNr |
CSB-EP010822MO-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
P17879 |
Gene Names |
Hspa1b |
Organism |
Mus musculus (Mouse) |
AA Sequence |
AKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNR TTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAK RLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVN YKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTN AVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP TAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILT IDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFK RKHKKDISQNKRAVRRLRTACERAKRTLSSSTQAS LEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEP VEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQ DFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSE NVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIP TKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLL GRFELSGIPPAPRGVPQIEVTFDIDANGILNVTAT DKSTGKANKITITNDKGRLSKEEIERMVQEAERYK AEDEVQRDRVAAKNALESYAFNMKSAVEDEGLKGK LSEADKKKVLDKCQEVISWLDSNTLADKEEFVHKR EELERVCSPIISGLYQGAGAPGAGGFGAQAPPKGA SGSGPTIEEVD |
Expression Region |
2-642aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
86 kDa |
Alternative Name(s) |
Heat shock 70KDA protein 1 Short name: HSP70.1 |
Relevance |
In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. Essential for STUB1-mediated ubiquitination and degradation of FOXP3 in regulatory T-cells (Treg) during inflammation. |
Reference |
"Characterization and sequence of a mouse hsp70 gene and its expression in mouse cell lines."Hunt C., Calderwood S.Gene 87:199-204(1990) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The co-chaperones have been shown to not only regulate different steps of the ATPase cycle, but they also have an individual specificity such that one co-chaperone may promote folding of a substrate while another may promote degradation. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release. The co-chaperones are of three types |
Subcellular Location |
Cytoplasm, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome |
Protein Families |
Heat shock protein 70 family |
Tissue Specificity |
Testis-specific. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.