Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
E.coli |
ArtNr |
CSB-EP010993HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Signal Transduction |
Uniprot ID |
P51553 |
Gene Names |
IDH3G |
Organism |
Homo sapiens (Human) |
AA Sequence |
FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVK SVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRR NRVALKGNIETNHNLPPSHKSRNNILRTSLDLYAN VIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEH ESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRK KVTAVHKANIMKLGDGLFLQCCREVAARYPQITFE NMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVC AGLVGGPGLVAGANYGHVYAVFETATRNTGKSIAN KNIANPTATLLASCMMLDHLKLHSYATSIRKAVLA SMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGR AVEA |
Expression Region |
40-393aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
54.8 kDa |
Alternative Name(s) |
Isocitric dehydrogenase subunit gammaNAD(+)-specific ICDH subunit gamma |
Reference |
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Regulatory subunit which plays a role in the allosteric regulation of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers. |
Subcellular Location |
Mitochondrion |
Protein Families |
Isocitrate and isopropylmalate dehydrogenases family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.