Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
E.coli |
ArtNr |
CSB-EP011022HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Immunology |
Uniprot ID |
O14879 |
Gene Names |
IFIT3 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLE DRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAA LECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYY HLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDC EEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSG LAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVK VLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLR SAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQ IGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAM DYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEG LSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGS IFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN |
Expression Region |
1-490aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
72 kDa |
Alternative Name(s) |
CIG49ISG-60Interferon-induced 60KDA protein ; IFI-60KInterferon-induced protein with tetratricopeptide repeats 4 ; IFIT-4Retinoic acid-induced gene G protein ; P60 ; RIG-G |
Relevance |
IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS-mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exihibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin-dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2. |
Reference |
Use of differential display analysis to assess the effect of human cytomegalovirus infection on the accumulation of cellular RNAs induction of interferon-responsive RNAs.Zhu H., Cong J.-P., Shenk T.Proc. Natl. Acad. Sci. U.S.A. 94:13985-13990(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS-mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exihibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin-dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2. |
Subcellular Location |
Cytoplasm, Mitochondrion |
Protein Families |
IFIT family |
Tissue Specificity |
Expression significantly higher in peripheral blood mononuclear cells (PBMCs) and monocytes from systemic lupus erythematosus (SLE) patients than in those from healthy individuals (at protein level). Spleen, lung, leukocytes, lymph nodes, placenta, bone marrow and fetal liver. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.