Comparison

Recombinant Human Interferon-induced protein with tetratricopeptide repeats 3(IFIT3)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP011022HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
CIG49ISG-60Interferon-induced 60 kDa protein ; IFI-60KInterferon-induced protein with tetratricopeptide repeats 4 ; IFIT-4Retinoic acid-induced gene G protein ; P60 ; RIG-G
AA Sequence
MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLE DRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAA LECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYY HLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDC EEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSG LAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVK VLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLR SAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQ IGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAM DYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEG LSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGS IFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN
Research Topic
Immunology
Uniprot ID
O14879
Gene Names
IFIT3
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-490aa
MW of Fusion Proten
72
Sequence Info
Full Length
Relevance
IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS-mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exihibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin-dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2.
Reference
Use of differential display analysis to assess the effect of human cytomegalovirus infection on the accumulation of cellular RNAs induction of interferon-responsive RNAs.Zhu H., Cong J.-P., Shenk T.Proc. Natl. Acad. Sci. U.S.A. 94:13985-13990(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close