« Zurück
Startseite /
Recombinant Human Interferon alpha/beta receptor 2(IFNAR2),partial

Recombinant Human Interferon alpha/beta receptor 2(IFNAR2),partial

ArtNr	CSB-EP011047HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Neural Lineage Markers Neural Transcription Factors Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ISYDSPDYTDESCTFKISLRNFRSILSWELKNHSI VPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLT DEWRSTHEAYVTVLEGFSGNTTLFSCSHNFWLAID MSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDL SLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLI PNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQES ESAESAK
Protein Familie	Type II cytokine receptor family
Citations	The human interferon alpha/beta receptor characterization and molecular cloning.Novick D., Cohen B., Rubinstein M.Cell 77:391-400(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interferon alpha binding protein,Type I interferon receptor 2
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	40.8 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 3 is a potent inhibitor of type I IFN receptor activity.
Expression Region	27-243aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation
Subcellular Location	Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted
Tissue Specificity	Isoform 3 is detected in the urine (at protein level) (PubMed:8181059, PubMed:7759950). Expressed in blood cells. Expressed in lymphoblastoid and fibrosarcoma cell lines.
Involvement in disease	Immunodeficiency 45 (IMD45)
Pathway	Jak-STATsignalingpathway
Gene Names	IFNAR2
Sequence Info	Extracellular Domain
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP011047HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 18.12.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern