Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
E.coli |
ArtNr |
CSB-EP011050MQG-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
O35735 |
Gene Names |
IFNG |
Organism |
Marmota monax (Woodchuck) |
AA Sequence |
QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDK WKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSM DTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKI QRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRR ASK |
Expression Region |
24-166aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
20.6 kDa |
Alternative Name(s) |
Short name:IFN-gamma |
Relevance |
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. |
Reference |
"Molecular cloning of the woodchuck cytokines: TNF-alpha, IFN-gamma, and IL-6."Lohrengel B., Lu M., Roggendorf M.Immunogenetics 47:332-335(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. |
Subcellular Location |
Secreted |
Protein Families |
Type II (or gamma) interferon family |
Tissue Specificity |
Released primarily from activated T lymphocytes. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.