« Zurück
Startseite /
Recombinant Mouse Lipoprotein lipase(Lpl)

Recombinant Mouse Lipoprotein lipase(Lpl)

ArtNr	CSB-EP013065MOe1-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	ADAGRDFSDIESKFALRTPEDTAEDTCHLIPGLAD SVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVA ALYKREPDSNVIVVDWLYRAQQHYPVSAGYTKLVG NDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGV AGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDD ADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG TFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSI HLF
Protein Familie	AB hydrolase superfamily, Lipase family
Citations	"A tissue-specific atlas of mouse protein phosphorylation and expression." Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P. Cell 143:1174-1189(2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	LPL
Lieferbar
Manufacturer - Conjugate / Tag	Tag-Free
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	50.3 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Cancer
Relevance	The primary function of this lipase is the hydrolysis of triglycerides of circulating chylomicrons and very low density lipoproteins. Binding to heparin sulfate proteogylcans at the cell surface is vital to the function. The apolipoprotein, APOC2, acts as a coactivator of LPL activity in the presence of lipids on the luminal surface of vascular endothelium.
Expression Region	28-474aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	The primary function of this lipase is the hydrolysis of triglycerides of circulating chylomicrons and very low density lipoproteins (VLDL). Binding to heparin sulfate proteogylcans at the cell surface is vital to the function. The apolipoprotein, APOC2, acts as a coactivator of LPL activity in the presence of lipids on the luminal surface of vascular endothelium.
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor, Secreted
Tissue Specificity	Expressed in liver, epididymal fat, heart, psoas muscle, lactating mammary gland, adrenal, lung, and ovary. Highest levels in heart and adrenal gland.
Gene Names	Lpl
Sequence Info	Full Length of Mature Protein
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP013065MOe1-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 23.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern