« Zurück
Startseite /
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)

ArtNr	CSB-EP013246HU-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQI KLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVT YPAHRDCYLGDLCNS
Citations	"Transcriptional analysis of a novel cluster of LY-6 family members in the human and mouse major histocompatibility complex: five genes with many splice forms." Mallya M., Campbell R.D., Aguado B. Genomics 80:113-123(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Megakaryocyte-enhanced gene transcript 1 protein; C6orf23, G6D, MEGT1, NG25
Lieferbar
Manufacturer - Targets	LY6G6D
Manufacturer - Conjugate / Tag	N-terminal 10xHis-B2M-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	25.5 kDa
Expression Region	20-104aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor, Cell projection, filopodium
Tissue Specificity	Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen.
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP013246HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern