« Zurück
Home /
Recombinant Human Monoglyceride lipase(MGLL)

Recombinant Human Monoglyceride lipase(MGLL)

Hersteller	Cusabio
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	E.coli
ArtNr	CSB-EP013787HU-50
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cardiovascular
Uniprot ID	Q99685
Gene Names	MGLL
Organism	Homo sapiens (Human)
AA Sequence	MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYW KPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDL LVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVD SMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFA GMVLISPLVLANPESATTFKVLAAKVLNLVLPNLS LGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFG IQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSK GAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTN SVFHEINMWVSQRTATAGTASPP
Expression Region	1-303aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	60.3 kDa
Alternative Name(s)	HU-K5 Lysophospholipase homolog Lysophospholipase-like Monoacylglycerol lipase
Relevance	Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth
Reference	"A novel poxvirus gene and its human homolog are similar to an E. coli lysophospholipase." Wall E.M., Cao J.X., Chen N., Buller R.M.L., Upton C. Virus Res. 52:157-167(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (By similarity). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth
Subcellular Location	Cytoplasm, cytosol, Membrane, Peripheral membrane protein
Protein Families	AB hydrolase superfamily, Monoacylglycerol lipase family
Tissue Specificity	Detected in adipose tissue, lung, liver, kidney, brain and heart.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen