« Zurück
Home /
Recombinant Rat Multiple inositol polyphosphate phosphatase 1(Minpp1)

Recombinant Rat Multiple inositol polyphosphate phosphatase 1(Minpp1)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP013831RA-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	O35217
Gene Names	Minpp1
Organism	Rattus norvegicus (Rat)
AA Sequence	SLPGRGDPVASVLSPYFGTKTRYEDVNPWLLGDPV APRRDPELLAGTCTPVQLVALIRHGTRYPTTKQIR KLRQLQGLLQTRESVDGGSRVAAALDQWPLWYDDW MDGQLVEKGRQDMRQLALRLAALFPDLFCRENYGR LRLITSSKHRCVDSSAAFLQGLWQHYHPGLPPPDV SDMECDPPRVNDKLMRFFDHCEKFLTEVERNATAL YHVEAFKTGPEMQTVLKKVAATLQVPVNNLNADLI QVAFFTCSFDLAIQGVHSPWCDVFDVDDAKVLEYL NDLKQYWKRSYGYAINSRSSCNLFQDIFLHLDKAV EQKQRSQPVSSSVILQFGHAETLLPLLSLMGYFKD KEPLTAYNFEEQVHREFRSGHIVPYASNLIFVLYH CEDAQTPQEKFQIQMLLNEKVLPLAHSQKTVALYE DLKNHYQDILQSCQTSKECNLPKVNITSDEL
Expression Region	31-481aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	55.6 kDa
Alternative Name(s)	2, 3-bisphosphoglycerate 3-phosphatase (EC:3.1.3.80) ; 2, 3-BPG phosphataseInositol (1, 3, 4, 5)-tetrakisphosphate 3-phosphatase ; Ins(1, 3, 4, 5)P(4) 3-phosphatase
Relevance	Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2, 3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2, 3-bisphosphoglycerate (2, 3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification).
Reference	The human and rat forms of multiple inositol polyphosphate phosphatase functional homology with a histidine acid phosphatase up-regulated during endochondral ossification.Caffrey J.J., Hidaka K., Matsuda M., Hirata M., Shears S.B.FEBS Lett. 442:99-104(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2, 3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2, 3-bisphosphoglycerate (2, 3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification). May play a role in the transition of chondrocytes from proliferation to hypertrophy (By similarity).
Subcellular Location	Endoplasmic reticulum lumen
Protein Families	Histidine acid phosphatase family, MINPP1 subfamily
Tissue Specificity	Widely expressed with highest levels in kidney and liver. Expressed in chondrocytes with an elevated expression in hypertrophic chondrocytes.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen