Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
E.coli |
ArtNr |
CSB-EP015270MO-10 |
Konjugat/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research areas |
Others |
Target / Protein |
Myc |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
P01108 |
AA Sequence |
MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQ QQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLC SPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTE LLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFS AAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTS SLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCT SSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETP PTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESG SSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPST RKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDT EENDKRRTHNVLERQRRNELKRSFFALRDQIPELE NNEKAPKVVILKKATAYILSIQADEHKLTSEKDLL RKRREQLKHKLEQLRNSGA |
Tag Info |
N-terminal GST-tagged |
Expression Region |
1-439aa |
Protein length |
Full Length |
MW |
76.0 kDa |
Alternative Name(s) |
Proto-oncogene c-MycTranscription factor p64 |
Relevance |
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. |
References |
SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. |
Subcellular Location |
Nucleus, nucleoplasm, Nucleus, nucleolus |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.