Comparison

Recombinant Mouse Myc proto-oncogene protein(Myc)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP015270MO-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Proto-oncogene c-MycTranscription factor p64
AA Sequence
MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQ QQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLC SPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTE LLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFS AAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTS SLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCT SSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETP PTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESG SSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPST RKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDT EENDKRRTHNVLERQRRNELKRSFFALRDQIPELE NNEKAPKVVILKKATAYILSIQADEHKLTSEKDLL RKRREQLKHKLEQLRNSGA
Research Topic
Others
Uniprot ID
P01108
Gene Names
Myc
Tag Info
N-terminal GST-tagged
Expression Region
1-439aa
MW of Fusion Proten
76
Sequence Info
Full Length
Relevance
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes.
Reference
SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close