Comparison

Recombinant Mouse Myc proto-oncogene protein(Myc)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP015270MO-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P01108
Gene Names
Myc
Organism
Mus musculus (Mouse)
AA Sequence
MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQ QQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLC SPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTE LLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFS AAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTS SLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCT SSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETP PTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESG SSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPST RKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDT EENDKRRTHNVLERQRRNELKRSFFALRDQIPELE NNEKAPKVVILKKATAYILSIQADEHKLTSEKDLL RKRREQLKHKLEQLRNSGA
Expression Region
1-439aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
76 kDa
Alternative Name
Proto-oncogene c-MycTranscription factor p64
Relevance
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes.
Reference
SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis.
Subcellular Location
Nucleus, nucleoplasm, Nucleus, nucleolus
Amount: 10ug
Available: In stock
Listprice: €230.66
Price: €230.66
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close