« Zurück
Home /
Recombinant Human Napsin-A(NAPSA)

Recombinant Human Napsin-A(NAPSA)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	100ug
Host	E.coli
ArtNr	CSB-EP015452HU-100
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Cell Biology
Uniprot ID	O96009
Gene Names	NAPSA
Organism	Homo sapiens (Human)
AA Sequence	KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTG SSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQAN GTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFG EALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPM DVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGS DPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTL CAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPL LAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYV IQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFL GTYVAVFDRGDMKSSARVGLARARTRGADLGWGET AQAQFPG
Expression Region	64-420aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	42.5 kDa
Alternative Name(s)	Aspartyl protease 4 ; ASP4 ; Asp 4Napsin-1TA01/TA02
Relevance	May be involved in processing of pneumocyte surfactant precursors.
Reference	Membrane-anchored aspartyl protease with Alzheimer's disease beta-secretase activity.Yan R., Bienkowski M.J., Shuck M.E., Miao H., Tory M.C., Pauley A.M., Brashier J.R., Stratman N.C., Mathews W.R., Buhl A.E., Carter D.B., Tomasselli A.G., Parodi L.A., Heinrikson R.L., Gurney M.E.Nature 402:533-537(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in processing of pneumocyte surfactant precursors.
Subcellular Location	Secreted
Protein Families	Peptidase A1 family
Tissue Specificity	Expressed predominantly in adult lung (type II pneumocytes) and kidney and in fetal lung. Low levels in adult spleen and very low levels in peripheral blood leukocytes.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP015452HU-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen