« Zurück
Home /
Recombinant Human Arylamine N-acetyltransferase 2(NAT2)

Recombinant Human Arylamine N-acetyltransferase 2(NAT2)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	E.coli
ArtNr	CSB-EP015471HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Signal Transduction
Target / Protein	NAT2
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P11245
AA Sequence	MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAV PFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQ VNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGM VHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISG KDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEF LNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQ TSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFN YKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLV PKPGDGSLTI
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-290aa
Protein length	Full Length
MW	49.5 kDa
Alternative Name(s)	Arylamide acetylase 2 N-acetyltransferase type 2 Short name: NAT-2 Polymorphic arylamine N-acetyltransferase Short name: PNAT
Relevance	Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
References	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
Subcellular Location	Cytoplasm
Protein Families	Arylamine N-acetyltransferase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP015471HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen