« Zurück
Home /
Recombinant Escherichia coli Acyl carrier protein(acpP)

Recombinant Escherichia coli Acyl carrier protein(acpP)

Hersteller	Cusabio
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
ArtNr	CSB-EP015636ENV-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	others
Target / Protein	acpP
Biologically active	Not Test
Expression system	E.coli
Species of origin	Escherichia coli (strain K12?
Uniprot ID	P0A6A8
AA Sequence	MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGA DSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAI DYINGHQA
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-78aa
Protein length	Full Length
MW	24.6 kDa
Alternative Name(s)	Cytosolic-activating factor
Relevance	Carrier of the growing fatty acid chain in fatty acid biosynthesis.
References	"Altered molecular form of acyl carrier protein associated with beta-ketoacyl-acyl carrier protein synthase II (fabF) mutants." Jackowski S., Rock C.O. J. Bacteriol. 169:1469-1473(1987)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen