« Zurück
Startseite /
Recombinant Human Neurofilament heavy polypeptide(NEFH),partial

Recombinant Human Neurofilament heavy polypeptide(NEFH),partial

ArtNr	CSB-EP015686HU-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Neurodegeneration Markers Glial Cell Markers
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	Myc, SUMO, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAG GTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGA ASSTDSLDTLSNGPEGCMVAVATSRSEKEQLQALN DRFAGYIDKVRQLEAHNRSLEGEAAALRQQQAGRS AMGELYEREVREMRGAVLRLGAARGQLRLEQEHLL EDIAHVRQRLDDEARQREEAEAAARALARFAQEAE AARVDLQKKAQALQEECGYLRRHHQEEVGELLGQI QGS
Protein Familie	Intermediate filament family
Citations	"PKN associates and phosphorylates the head-rod domain of neurofilament protein." Mukai H., Toshimori M., Shibata H., Kitagawa M., Shimakawa M., Miyahara M., Sunakawa H., Ono Y. J. Biol. Chem. 271:9816-9822(1996)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	200KDA neurofilament protein,Neurofilament triplet H protein
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	65.6 kDa
General Research Areas	Neuroscience
Relevance	Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. NF-H has an important function in mature axons that is not subserved by the two smaller NF proteins.
Expression Region	1-413aa
Protein Length	Partial
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Neurofilaments usually contain three intermediate filament proteins
Subcellular Location	Cytoplasm
Involvement in disease	Amyotrophic lateral sclerosis (ALS); Charcot-Marie-Tooth disease 2CC (CMT2CC)
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP015686HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 04.12.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern