« Zurück
Home /
Recombinant Mouse Homeobox protein Nkx-2.2(Nkx2-2)

Recombinant Mouse Homeobox protein Nkx-2.2(Nkx2-2)

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Metabolism Diabetes Neural Development Peptides & Proteins Recombinant Proteins Progenitor Markers
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-EP015842MO-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Others
Uniprot ID	P42586
Gene Names	Nkx2-2
Organism	Mus musculus (Mouse)
AA Sequence	MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEE SEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSD NPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPE PSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQT YELERRFRQQRYLSAPEREHLASLIRLTPTQVKIW FQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVR DGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHM QYNAQYSSASTPQYPTAHPLVQAQQWTW
Expression Region	1-273aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	46.1 kDa
Alternative Name(s)	Homeobox protein NK-2 homolog B
Relevance	Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter.
Reference	Regional expression of the homeobox gene Nkx-2.2 in the developing mammalian forebrain.Price M., Lazzaro D., Pohl T., Mattei M.-G., Ruether U., Olivo J.-C., Duboule D., di Lauro R.Neuron 8:241-255(1992)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter.
Subcellular Location	Nucleus
Protein Families	NK-2 homeobox family
Tissue Specificity	Expressed in restricted areas of the developing CNS: the hindbrain and forebrain, and pancreas.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP015842MO-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen