« Zurück
Home /
Recombinant Human Nicotinamide N-methyltransferase(NNMT)

Recombinant Human Nicotinamide N-methyltransferase(NNMT)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP015906HU-500
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P40261
Gene Names	NNMT
Organism	Homo sapiens (Human)
AA Sequence	MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAES QILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQ LLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAF DWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLK CDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPT YCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQK FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSST MANNEGLFSLVARKLSRPL
Expression Region	1-264aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	56.6 kDa
Relevance	Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.
Reference	"Human liver nicotinamide N-methyltransferase. cDNA cloning, expression, and biochemical characterization." Aksoy S., Szumlanski C.L., Weinshilboum R.M. J. Biol. Chem. 269:14835-14840(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.
Subcellular Location	Cytoplasm
Protein Families	Class I-like SAM-binding methyltransferase superfamily, NNMT/PNMT/TEMT family
Tissue Specificity	Predominantly expressed in the liver. A lower expression is seen in the kidney, lung, skeletal muscle, placenta and heart. Not detected in the brain or pancreas.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP015906HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen