« Zurück
Home /
Recombinant Rat Atrial natriuretic peptide receptor 3(Npr3),partial

Recombinant Rat Atrial natriuretic peptide receptor 3(Npr3),partial

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins Calcium Binding Protein Markers
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-EP016025RA1-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	P41740
Gene Names	Npr3
Organism	Rattus norvegicus (Rat)
AA Sequence	EALAAQKIEVLVLLPRDDSYLFSLARVRPAIEYAL RSVEGNGTGRKLLPPGTRFQVAYEDSDCGNRALFS LVDRVAAARGAKPDLILGPVCEYAAAPVARLASHW DLPMLSAGALAAGFQHKDTEYSHLTRVAPAYAKMG EMMLALFRHHHWSRAALLYSDDKLERNCYFTLEGV HEVFQEEGLHTSAYNFDETKDLDLDDIVRYIQGSE RVVIMCASGDTIRRIMLAVHRHGMTSGDYAFFNIE LFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLL RTAKPEFEKFSMEVKSSVEKQGLNEEDYVNMFVEG FHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNR TFEGIAGQVSIDANGDRYGDFSVVAMTDTEAGTQE VIGDYFGKEGRFKMRSNVKYPWGSLKLRIDETRIV EHTNSSPCKSCGLEESA
Expression Region	41-477aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	64.9 kDa
Alternative Name(s)	Atrial natriuretic peptide clearance receptorAtrial natriuretic peptide receptor type C ; ANP-C ; ANPR-C ; NPR-C
Relevance	Receptor for the natriuretic peptide hormones, binding with similar affinities atrial natriuretic peptide NPPA/ANP, brain natriuretic peptide NPPB/BNP, and C-type natriuretic peptide NPPC/CNP. May function as a clearance receptor for NPPA, NPPB and NPPC, regulating their local concentrations and effects. May regulate diuresis, blood pressure and skeletal development. Does not have guanylate cyclase activity .
Reference	A single residue determines the distinct pharmacology of rat and human natriuretic peptide receptor-C.Engel A.M., Schoenfeld J.R., Lowe D.G.J. Biol. Chem. 269:17005-17008(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for the natriuretic peptide hormones, binding with similar affinities atrial natriuretic peptide NPPA/ANP, brain natriuretic peptide NPPB/BNP, and C-type natriuretic peptide NPPC/CNP. May function as a clearance receptor for NPPA, NPPB and NPPC, regulating their local concentrations and effects. May regulate diuresis, blood pressure and skeletal development. Does not have guanylate cyclase activity.
Subcellular Location	Membrane, Single-pass type I membrane protein
Protein Families	ANF receptor family
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP016025RA1-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen