Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
50ug |
Host |
E.coli |
ArtNr |
CSB-EP016058HU-50 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research areas |
Epigenetics and Nuclear Signaling |
Target / Protein |
NR2F6 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P10588 |
AA Sequence |
MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASP PGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV FTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHR NQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVA ASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLR AEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLL FSTVEWARHAPFFPELPVADQVALLRLSWSELFVL NAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMD QVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDA CGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRF GRLLLRLPALRAVPASLISQLFFMRLVGKTPIETL IRDMLLSGSTFNWPYGSGQ |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
1-404aa |
Protein length |
Full Length |
MW |
59 kDa |
Alternative Name(s) |
V-erbA-related protein 2 Short name: EAR-2 |
Relevance |
Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4+ T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC). |
References |
"Identification of two novel members of erbA superfamily by molecular cloning: the gene products of the two are highly related to each other."Miyajima N., Kadowaki Y., Fukushige S., Shimizu S., Semba K., Yamanashi Y., Matsubara K., Toyoshima K., Yamamoto T.Nucleic Acids Res. 16:11057-11074(1988) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC). |
Subcellular Location |
Nucleus |
Protein Families |
Nuclear hormone receptor family, NR2 subfamily |
Tissue Specificity |
Expressed in heart, placenta, liver, skeletal muscle, kidney and pancreas. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.