Vergleich

Recombinant Mouse Nuclear receptor subfamily 2 group F member 6(Nr2f6)

ArtNr CSB-EP016058MO-500
Hersteller Cusabio
Menge 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Konjugat/Tag Myc, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAMVTGGWGDPGGDTNGVDKAGGSYPRATEDDSAS PPGATSDAEPGDEERPGLQVDCVVCGDKSSGKHYG VFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHH RNQCQYCRLKKCFRVGMRKEAVQRGRIPHALPGPA ACSPPGATGVEPFTGPPVSELIAQLLRAEPYPAAG RFGGGGAVLGIDNVCELAARLLFSTVEWARHAPFF PELPAADQVALLRLSWSELFVLNAAQAALPLHTAP LLA
Protein Familie Nuclear hormone receptor family, NR2 subfamily
Citations "Abnormal development of the locus coeruleus in Ear2(Nr2f6)-deficient mice impairs the functionality of the forebrain clock and affects nociception."
Warnecke M., Oster H., Revelli J.P., Alvarez-Bolado G., Eichele G.
Genes Dev. 19:614-625(2005)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias COUP transcription factor 3 (COUP-TF3) (V-erbA-related protein 2) (EAR-2) (Ear-2) (Ear2) (Erbal2)
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
49.4 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4+ T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus.
Expression Region
1-390aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC).
Subcellular Location
Nucleus
Gene Names
Nr2f6
Sequence Info
Full Length
Organism
Mus musculus (Mouse)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen