« Zurück
Home /
Recombinant Mouse Nuclear respiratory factor 1(Nrf1)

Recombinant Mouse Nuclear respiratory factor 1(Nrf1)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-EP016076MO-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q9WU00
Gene Names	Nrf1
Organism	Mus musculus (Mouse)
AA Sequence	MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEH SMLSADEDSPSSPEDTSYDDSDILNSTAADEVTAH LAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRK RQQTRLLRKLRATLDEYTTRVGQQAIVLCISPSKP NPVFKVFGAAPLENVVRKYKSMILEDLESALAEHA PAPQEVNSELPPLTIDGIPVSVDKMTQAQLRAFIP EMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRS DVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLY AFEDQQTQTQATTTHSIAHLVPSQTVVQTFSNPDG TVSLIQVGTGATVATLADASELPTTVTVAQVNYSA VADGEVEQNWATLQGGEMTIQTTQASEATQAVASL AEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIP VSMYQTVVTSLAQGNGPVQVAMAPVTTRISDSAVT MDGQAVEVVTLEQ
Expression Region	1-503aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	69.6 kDa
Alternative Name(s)	Nuclear respiratory factor 1 Short name: NRF-1 Alternative name(s): Alpha palindromic-binding protein Short name: Alpha-pal
Relevance	Transcription factor that activates the expression of the EIF2S1 (EIF2-alpha) gene. Links the transcriptional modulation of key metabolic genes to cellular growth and development. Implicated in the control of nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication
Reference	Coding sequence, chromosomal localization, and expression pattern of Nrf1: the mouse homolog of Drosophila erect wing.Schaefer L., Engman H., Miller J.B.Mamm. Genome 11:104-110(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transcription factor that activates the expression of the EIF2S1 (EIF2-alpha) gene. Links the transcriptional modulation of key metabolic genes to cellular growth and development. Implicated in the control of nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication (By similarity).
Subcellular Location	Nucleus
Protein Families	NRF1/Ewg family
Tissue Specificity	Widely expressed in embryonic, fetal, and adult tissues.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP016076MO-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen