Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
200ug |
Host |
E.coli |
ArtNr |
CSB-EP016264MO-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research areas |
Neuroscience |
Target / Protein |
Ocm |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
P51879 |
AA Sequence |
SITDILSADDIAAALQECQDPDTFEPQKFFQTSGL SKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRF QSDARELTESETKSLMDAADNDGDGKIGADEFQEM VHS |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
2-109aa |
Protein length |
Full Length of Mature Protein |
MW |
28.1 kDa |
Alternative Name(s) |
Parvalbumin beta |
Relevance |
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. |
References |
"The intracisternal A particle derived solo LTR promoter of the rat oncomodulin gene is not present in the mouse gene."Banville D., Rotaru M., Boie Y.Genetica 86:85-97(1992) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. |
Protein Families |
Parvalbumin family |
Tissue Specificity |
Found in tumor tissues and not detected in normal tissues. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.