« Zurück
Home /
Recombinant Human Glycodelin(PAEP)

Recombinant Human Glycodelin(PAEP)

Hersteller	Cusabio
Kategorie	Food Safety Allergenes Hormones Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-EP017381HU-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Tags & Cell Markers
Target / Protein	PAEP
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P09466
AA Sequence	MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATL KAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKK VLGEKTENPKKFKINYTVANEATLLDTDYDNFLFL CLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAF RPLPRHLWYLLDLKQMEEPCRF
Tag Info	N-terminal 10xHis-tagged
Expression Region	19-180aa
Protein length	Full Length of Mature Protein
MW	22.4 kDa
Alternative Name(s)	Placental protein 14 Short name: PP14 Pregnancy-associated endometrial alpha-2 globulin Short name: PAEG Short name: PEG Progestagen-associated endometrial protein Progesterone-associated endometrial protein
Relevance	This protein is, quantitatively, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy.
References	"Multiple forms of mRNA encoding human pregnancy-associated endometrial alpha 2-globulin, a beta-lactoglobulin homologue."Garde J., Bell S.C., Eperon I.C.Proc. Natl. Acad. Sci. U.S.A. 88:2456-2460(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities
Subcellular Location	Secreted
Protein Families	Calycin superfamily, Lipocalin family
Tissue Specificity	This protein is, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy (PubMed:3667877). Glycodelin-A is expressed in amniotic fluid, endometrium/decidua and maternal serum (at protein level) (PubMed:3194393). Glycodelin-F is expressed in follicular fluid, luteinized granulosa cells and the oviduct (at protein level) (PubMed:12672671). Glycodelin-S is expressed in seminal plasma and seminal vesicles (at protein level) (PubMed:9239694). Glycodelin-C is detected in cumulus cells (at protein level), but cumulus cells do not synthesize Glycodelin-C but take up and convert glycodelin-A and -F vis glycan remodeling (PubMed:17192260).
Tag Information	N-terminal 10xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen