« Zurück
Home /
Recombinant Human Procollagen C-endopeptidase enhancer 2(PCOLCE2)

Recombinant Human Procollagen C-endopeptidase enhancer 2(PCOLCE2)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-EP017632HU-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cell Biology
Uniprot ID	Q9UKZ9
Gene Names	PCOLCE2
Organism	Homo sapiens (Human)
AA Sequence	QSPERPVFTCGGILTGESGFIGSEGFPGVYPPNSK CTWKITVPEGKVVVLNFRFIDLESDNLCRYDFVDV YNGHANGQRIGRFCGTFRPGALVSSGNKMMVQMIS DANTAGNGFMAMFSAAEPNERGDQYCGGLLDRPSG SFKTPNWPDRDYPAGVTCVWHIVAPKNQLIELKFE KFDVERDNYCRYDYVAVFNGGEVNDARRIGKYCGD SPPAPIVSERNELLIQFLSDLSLTADGFIGHYIFR PKKLPTTTEQPVTTTFPVTTGLKPTVALCQQKCRR TGTLEGNYCSSDFVLAGTVITTITRDGSLHATVSI INIYKEGNLAIQQAGKNMSARLTVVCKQCPLLRRG LNYIIMGQVGEDGRGKIMPNSFIMMFKTKNQKLLD ALKNKQC
Expression Region	24-415aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	59.3 kDa
Alternative Name(s)	Procollagen COOH-terminal proteinase enhancer 2 Short name: PCPE-2 Short name: Procollagen C-proteinase enhancer 2
Relevance	Binds to the C-terminal propeptide of types I and II procollagens and may enhance the cleavage of that propeptide by BMP1.
Reference	"PCOLCE2 encodes a functional procollagen C-proteinase enhancer (PCPE2) that is a collagen-binding protein differing in distribution of expression and post-translational modification from the previously described PCPE1."Steiglitz B.M., Keene D.R., Greenspan D.S.J. Biol. Chem. 277:49820-49830(2002)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to the C-terminal propeptide of types I and II procollagens and may enhance the cleavage of that propeptide by BMP1.
Subcellular Location	Secreted
Tissue Specificity	Highly expressed in the heart, trabecular meshwork, pituitary gland, bladder, mammary gland, trachea and placenta and weakly expressed in the brain. Expressed in cartilage.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP017632HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen