« Zurück
Home /
Recombinant Rat Neuroendocrine convertase 2(Pcsk2)

Recombinant Rat Neuroendocrine convertase 2(Pcsk2)

Hersteller	Cusabio
Kategorie	Metabolism Diabetes Regulation of Appetite Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	100ug
Host	E.coli
ArtNr	CSB-EP017642RA-100
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Signal Transduction
Uniprot ID	P28841
Gene Names	Pcsk2
Organism	Rattus norvegicus (Rat)
AA Sequence	GYRDINEIDINMNDPLFTKQWYLFNTGQADGTPGL DLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAY NYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAG EVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDI IEASSISHMPQLIDIYSASWGPTDNGKTVDGPREL TLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNC DGYASSMWTISINSAINDGRTALYDESCSSTLAST FSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPE AAGVFALALEANVDLTWRDMQHLTVLTSKRNQLHD EVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDW KTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNAC EGKENFVRYLEHVQAVITVNATRRGDLNINMTSPM GTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDA RGTWTLELGFVGSAPQKGLLKEWTLMLHGTQSAPY IDQVVRDYQSKLAMSKKQELEEELDEAVERSLQSI LRKN
Expression Region	109-637aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	62.3 kDa
Alternative Name(s)	NEC 2 Alternative name(s): KEX2-like endoprotease 2 Prohormone convertase 2 Proprotein convertase 2 Short name: PC2
Relevance	Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Responsible for the release of glucagon from proglucagon in pancreatic A cells (By similarity).
Reference	Isolation of two complementary deoxyribonucleic acid clones from a rat insulinoma cell line based on similarities to Kex2 and furin sequences and the specific localization of each transcript to endocrine and neuroendocrine tissues in rats.Hakes D.J., Birch N.P., Mezey A., Dixon J.E.Endocrinology 129:3053-3063(1991).
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Responsible for the release of glucagon from proglucagon in pancreatic A cells (By similarity).
Subcellular Location	Cytoplasmic vesicle, secretory vesicle, Secreted
Protein Families	Peptidase S8 family, Furin subfamily
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP017642RA-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen